Tutorial: Designing a GFP CDS for N. benthamiana
This tutorial walks through a complete synonymous CDS design workflow using Green Fluorescent Protein (GFP) as an example target, showing how to go from an amino acid sequence to a Nicotiana benthamiana-oriented CDS candidate.
Prerequisites
Verify installation:
Input Sequence
We use the Aequorea victoria GFP sequence (239 amino acids) as our target protein. Save it as gfp.fasta:
>GFP|Aequorea_victoria|239aa
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWP
TLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDT
LVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQL
ADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Step 1: Run Optimization (CLI)
Run the balanced profile — the recommended starting point for N. benthamiana CDS design:
For exploratory Tobacco BY-2 sequence-context review:
Expected output:
Optimizing with Profile-based v3.4.5...
Saved to: gfp_optimized.fasta
Metrics:
- cai: 0.769
- gc_percent: 58.72
- score: 0.856
The designed CDS begins with ATGGTGAGCAAGGGCGAGGAA... and can be reviewed for synthesis or downstream assembly. Reverse translation is stochastic, so exact codons and metrics vary slightly between runs.
What happened:
| Metric | Value | Target range |
|---|---|---|
| CAI | 0.769 | — (higher is better) |
| GC% | 58.72% | 55–65% |
| Internal stop codons | 0 | 0 (hard requirement) |
| Rare codon runs | 0 | 0 (ribosome stalling risk) |
Step 2: Compare Profiles
Different design goals call for different profiles. Use --compare-profiles to evaluate all options at once:
factorforge optimize gfp.fasta --engine profile \
--compare-profiles balanced,high_cai,gc_target,assembly_friendly \
--scan-mode fast
Output:
Profile comparison results:
─────────────────────────────────────────────
Profile CAI GC% Score
─────────────────────────────────────────────
balanced 0.770 57.74 0.856
high_cai 1.000 31.24 0.889
gc_target 0.774 59.83 0.972
assembly_friendly 0.779 57.18 0.905
─────────────────────────────────────────────
How to choose:
| Profile | Best for |
|---|---|
balanced |
General N. benthamiana CDS design review; good CAI with GC% in target range |
high_cai |
CAI-focused comparison; note GC% may fall outside the active host GC range |
gc_target |
When GC% must hit a specific value (defaults to the host midpoint of 43.5% for the current NbeV1.1 software default; pass --target-gc for other values, e.g. specific vector requirements) |
assembly_friendly |
MoClo / Golden Gate workflows; avoids problematic restriction sites |
For most N. benthamiana sequence-design tasks, balanced is the recommended starting profile.
Step 3: Python API
The same optimization is available programmatically:
from factorforge.engines import EngineRegistry
# Load the profile engine
optimizer = EngineRegistry.get("profile")
gfp_aa = (
"MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWP"
"TLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDT"
"LVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQL"
"ADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK"
)
result = optimizer.optimize(gfp_aa, profile="balanced")
print(f"Optimized CDS: {result.sequence[:60]}...")
print(f"CAI: {result.metrics['cai']:.3f}")
print(f"GC%: {result.metrics['gc_percent']:.2f}")
print(f"Score: {result.metrics['score']:.3f}")
To compare profiles programmatically:
profiles = ["balanced", "high_cai", "gc_target", "assembly_friendly"]
for p in profiles:
r = optimizer.optimize(gfp_aa, profile=p, scan_mode="fast")
cai = r.metrics["cai"]
gc = r.metrics["gc_percent"]
score = r.metrics["score"]
print(f"{p:<20} CAI={cai:.3f} GC={gc:.2f}% Score={score:.3f}")
Step 4: Custom Restriction Site Removal
For MoClo / Golden Gate assembly, remove specific restriction sites:
factorforge optimize gfp.fasta --engine profile --profile assembly_friendly \
--scan-include restriction_sites \
-o gfp_moclo.fasta
The engine performs synonymous substitutions to eliminate recognition sequences while preserving the amino acid sequence.
Step 5: Downstream Use
The output FASTA can be reviewed for:
- Gene synthesis — review against vendor and project constraints before ordering
- MoClo Level 0 — use with the
assembly_friendlyprofile; check for BsaI/BpiI site removal - Agroinfiltration — clone into a binary vector (e.g. pEAQ-HT, pK7WG2) for A. tumefaciens-mediated delivery
Wet-lab validation
The 5' Ramp and Viral Delivery profiles are currently pending wet-lab validation and are disabled by default. Share public-safe summaries via Share Wet-lab Results (GitHub); use eijex.lab@gmail.com for private or sensitive summaries.
Summary
| Step | Command |
|---|---|
| Install | pip install factorforge-cds |
| Optimize (balanced) | factorforge optimize gfp.fasta --engine profile --profile balanced -o out.fasta |
| Compare profiles | factorforge optimize gfp.fasta --engine profile --compare-profiles balanced,high_cai,gc_target |
| Assembly-oriented | factorforge optimize gfp.fasta --engine profile --profile assembly_friendly -o out.fasta |
GFP optimization results (balanced profile, N=1):
| Metric | Result |
|---|---|
| Input length | 239 aa |
| Output CDS length | 720 bp (239 × 3 + stop) |
| CAI | 0.781 |
| GC% | 57.32% |
| Internal stop codons | 0 |
| Rare codon runs (≥3) | 0 |
| Composite score | 0.843 |